PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn019011
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family LBD
Protein Properties Length: 168aa    MW: 18555.3 Da    PI: 7.0007
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn019011genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260143.37.4e-4561051100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +Ca+Ck+lrr+CakdC++apyfp+++p+kfa+vhk+FGasn++k+l++lp ++r da+sslvyeA+ar+rdPvyG++g i+ lq+q++ql+ +la++++
  Achn019011   6 PCASCKLLRRRCAKDCIFAPYFPSDDPQKFAMVHKVFGASNISKMLQELPIHQRADAVSSLVYEANARVRDPVYGCIGAISYLQNQVSQLQMQLAVAQA 104
                 7***********************************************************************************************998 PP

      DUF260 100 e 100
                 e
  Achn019011 105 E 105
                 7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.9845106IPR004883Lateral organ boundaries, LOB
PfamPF031955.1E-446103IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 168 aa     Download sequence    Send to blast
MGGNSPCASC KLLRRRCAKD CIFAPYFPSD DPQKFAMVHK VFGASNISKM LQELPIHQRA  60
DAVSSLVYEA NARVRDPVYG CIGAISYLQN QVSQLQMQLA VAQAEILCIQ MQQEPTLPAT  120
PQLVDHPDDK SFFLPHPYLN FASSSSSVIQ EYSLKRESLF GHDMVSS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006435806.14e-98hypothetical protein CICLE_v10032929mg
RefseqXP_006486261.14e-98PREDICTED: LOB domain-containing protein 12
SwissprotQ8LBW36e-77LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A067FN825e-98A0A067FN82_CITSI; Uncharacterized protein
TrEMBLV4TH275e-98V4TH27_9R
STRINGPOPTR_0008s07280.12e-91(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.14e-78LBD family protein